| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-23-c-16 | 15-b-31 |
Chain Sequence |
DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
|
| sequence length |
75
|
| structure length |
75
|
| publication title |
TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
pubmed doi rcsb |
| molecule tags |
Transport protein
|
| molecule keywords |
Transient receptor potential cation channel subfamily V memb
|
| source organism |
Rattus norvegicus
|
| ec nomenclature | |
| pdb deposition date | 2016-03-14 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...