5J4NA

Crystal structure of the l-arginine/agmatine antiporter adic in complex with agmatine at 2.6 angstroem resolution
Warning
  • Chain breaks within knotoid 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 36-205 170 206-437 1-21 22-35 21 231 slipknot
view details
41 14-241 228 1-13 284-437 242-283 13 154 slipknot
Chain Sequence
ADAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNPYPLDAP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 12-236 225 1-11 250-437 237-249 11 188 slipknot
view details
4.1 6-249 244 1-5 256-437 250-255 5 182 slipknot
view details
4.1 9-261 253 1-8 270-437 262-269 8 168 slipknot
view details
3.2 16-270 255 1-15 286-437 271-285 15 152 slipknot
view details
3.2 14-260 247 1-7, 267-437 8-13, 261-266 7 171 slipknot
view details
1.1 26-219 194 1-15, 229-437 16-25, 220-228 15 209 slipknot
view details
3.2 23-264 242 1-15, 282-437 16-22, 265-281 15 156 slipknot
view details
2.1 40-289 250 1-15, 353-437 16-39, 290-352 15 85 slipknot
view details
2.1 39-364 326 365-437 1-16 17-38 16 72 slipknot
view details
2.1 33-208 176 1-18, 227-437 19-32, 209-226 18 211 slipknot
view details
2.1 36-203 168 1-19, 218-437 20-35, 204-217 19 220 slipknot
view details
2.1 36-217 182 1-33, 221-437 34-35, 218-220 33 217 slipknot
view details
2.1 36-220 185 1-32, 227-437 33-35, 221-226 32 211 slipknot
view details
2.1 33-226 194 1-25, 229-437 26-32, 227-228 25 209 slipknot
view details
1.1 38-230 193 1-26, 246-437 27-37, 231-245 26 192 slipknot
view details
1.1 40-223 184 1-28, 235-437 29-39, 224-234 28 203 slipknot
view details
1.1 40-234 195 1-37, 244-437 38-39, 235-243 37 194 slipknot
view details
1.1 41-227 187 1-39, 235-437 40-40, 228-234 39 203 slipknot
view details
1.1 41-236 196 1-39, 241-437 40-40, 237-240 39 197 slipknot
view details
1.1 42-226 185 1-40, 244-437 41-41, 227-243 40 194 slipknot
sequence length 437
structure length 437
publication title Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC
doi rcsb
molecule tags Transport protein
molecule keywords Arginine/agmatine antiporter
source organism Escherichia coli o157:h7
total genus Genus: 172
ec nomenclature
pdb deposition date 2016-04-01
KnotProt deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling