5JAFA

Leut na+-free return state, c2 form at ph 5
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31 41
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-262 225 263-505 1-19 20-37 19 242 slipknot
view details
41 14-294 281 1-13 351-505 295-350 13 155 slipknot
Chain Sequence
KREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEP----TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTFEKL--KDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPTHWTVW-----ITRFYIIGLFLFLTFLVFLAERRR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 12-284 273 1-11 298-494 285-297 11 197 slipknot
view details
4.1 12-297 286 1-11 306-494 298-305 11 189 slipknot
view details
4.1 8-323 316 1-7 334-494 324-333 7 161 slipknot
view details
3.2m 13-326 314 1-12 344-494 327-343 12 151 slipknot
view details
3.2 11-343 333 1-10 345-494 344-344 10 150 slipknot
view details
3.2 9-313 305 1-2, 319-494 3-8, 314-318 2 176 slipknot
view details
1.1 22-271 250 1-16, 282-494 17-21, 272-281 16 213 slipknot
view details
3.1 29-257 229 1-17, 271-494 18-28, 258-270 17 224 slipknot
view details
2.1 33-454 422 1-17, 489-494 18-32, 455-488 17 6 slipknot
view details
2.1 42-353 312 1-18, 395-494 19-41, 354-394 18 100 slipknot
view details
2.1 42-403 362 404-494 1-18 19-41 18 90 slipknot
view details
1.1 37-241 205 1-23, 255-494 24-36, 242-254 23 240 slipknot
view details
2.1 34-278 245 1-26, 288-494 27-33, 279-287 26 207 slipknot
view details
2.1 35-261 227 1-29, 272-494 30-34, 262-271 29 223 slipknot
view details
3.1 43-271 229 1-32, 289-494 33-42, 272-288 32 206 slipknot
view details
2.1 42-257 216 1-34, 271-494 35-41, 258-270 34 224 slipknot
view details
1.1 41-270 230 1-36, 272-494 37-40, 271-271 36 223 slipknot
missing residues 128-131, 230-231, 471-475
publication title A conserved leucine occupies the empty substrate site of LeuT in the Na(+)-free return state.
pubmed doi rcsb
structure length 494
molecule tags Transport protein
source organism Aquifex aeolicus (strain vf5)
sequence length 505
total genus Genus: 178
molecule keywords Transporter
ec nomenclature
pdb deposition date 2016-04-12
KnotProt deposition date 2016-06-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling