5JAGA

Leut t354h mutant in the outward-oriented, na+-free return state
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 193
Slipknot S +31 41

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-262 225 263-504 1-17 18-37 17 241 slipknot
view details
41 14-295 282 1-13 350-504 296-349 13 155 slipknot
Chain Sequence
KREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLHSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPTHW-----TVWITRFYIIGLFLFLTFLVFLAERR
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 14-286 273 1-13 301-496 287-300 13 196 slipknot
view details
3.2 11-300 290 1-10 309-496 301-308 10 188 slipknot
view details
4.1 8-312 305 1-7 318-496 313-317 7 179 slipknot
view details
3.2 16-330 315 1-15 349-496 331-348 15 148 slipknot
view details
4.1 12-300 289 1-10, 309-496 11-11, 301-308 10 188 slipknot
view details
3.2m 14-319 306 1-8, 327-496 9-13, 320-326 8 170 slipknot
view details
2.1 43-357 315 1-17, 400-496 18-42, 358-399 17 97 slipknot
view details
2.1 23-475 453 1-17, 485-496 18-22, 476-484 17 12 slipknot
view details
2.1 42-409 368 410-496 1-18 19-41 18 86 slipknot
view details
2.1 30-269 240 1-23, 276-496 24-29, 270-275 23 221 slipknot
view details
1.1 35-242 208 1-24, 255-496 25-34, 243-254 24 242 slipknot
view details
1.1 41-273 233 1-24, 291-496 25-40, 274-290 24 206 slipknot
view details
2.1 41-271 231 1-30, 274-496 31-40, 272-273 30 223 slipknot
view details
1.1 38-244 207 1-30, 257-496 31-37, 245-256 30 240 slipknot
view details
2.1 42-261 220 1-31, 276-496 32-41, 262-275 31 221 slipknot
sequence length 504
structure length 496
publication title A conserved leucine occupies the empty substrate site of LeuT in the Na(+)-free return state.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus (strain vf5)
missing residues 129-131, 471-475
total genus Genus: 193
ec nomenclature
pdb deposition date 2016-04-12
KnotProt deposition date 2016-06-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling