Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 77-141 | 65 | 1-76 | 145-158 | 142-144 | 76 | 14 | slipknot |
Chain Sequence |
RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 78-139 | 62 | 1-77 | 148-158 | 140-147 | 77 | 11 | slipknot | ||
view details |
![]() |
1.1 | 82-140 | 59 | 1-77, 147-158 | 78-81, 141-146 | 77 | 12 | slipknot |
sequence length |
158
|
structure length |
158
|
publication title |
Structural Insights into the Niemann-Pick C1 (NPC1)-Mediated Cholesterol Transfer and Ebola Infection
pubmed doi rcsb |
molecule tags |
Membrane protein
|
molecule keywords |
Niemann-Pick C1 protein
|
source organism |
Homo sapiens
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2016-05-01 |
KnotProt deposition date | 2016-06-17 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...