5K6DA

Structure of fs50 an antagonist of nav1.5
Cysteine knot
Loop Piercing
view details
7-c-31-b-59-c-52 44-b-72
Chain Sequence
WKVSERCLKGHGKFQADQEIGNGLATAKGQCKGTDSDQKKAGKCDKHCTGVCLGSGGSCGDGSSQKPNKEDCYCKSK
sequence length 77
structure length 77
publication title Structure and Function of FS50, a salivary protein from the flea Xenopsylla cheopis that blocks the sodium channel NaV1.5.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords Putative secreted salivary protein
source organism Xenopsylla cheopis
ec nomenclature
pdb deposition date 2016-05-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.