| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 7-c-31-b-59-c-52 | 44-b-72 |
Chain Sequence |
MWKVSERCLKGHGKFQADQEIGNGLATAKGQCKGTDSDQKKAGKCDKHCTGVCLGSGGSCGDGSSQKPNKEDCYCKSK
|
| sequence length |
78
|
| structure length |
78
|
| publication title |
Structure and Function of FS50, a salivary protein from the flea Xenopsylla cheopis that blocks the sodium channel NaV1.5.
pubmed doi rcsb |
| molecule tags |
Unknown function
|
| molecule keywords |
Putative secreted salivary protein
|
| source organism |
Xenopsylla cheopis
|
| ec nomenclature | |
| pdb deposition date | 2016-05-24 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
