5KGNA

1.95a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (2d)
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 13-446 434 1-12 472-530 447-471 12 59 slipknot
Chain Sequence
AMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKIKLAAALEHHH
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 24x -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
- 31 20-118 99 1-19, 119-177 19 59 knot
Fingerprint Knot forming loop Loop type
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ala53 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ala53 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... His468 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ala53 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> Asp426 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Ala53 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ala53 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Leu51 ... Ala20
probabilistic
K -31
Chain closureAla20 <-> His549
... His485 <->
Bridging ionMn604
<-> His430 ... Asp467 <->
Bridging ionZn605
<-> Ser86 ... Thr55 <->
Bridging ionMg603
<-> Ile50 ... Ala20
probabilistic
Chain Sequence
AMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKIKLAAALEHHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 7-448 442 1-6 453-530 449-452 6 78 slipknot
view details
3.1 13-452 440 1-12 471-530 453-470 12 60 slipknot
publication title Macrocycle peptides delineate locked-open inhibition mechanism for microorganism phosphoglycerate mutases.
pubmed doi rcsb
structure length 530
molecule tags Isomerase
source organism Caenorhabditis elegans
sequence length 530
total genus Genus: 195
molecule keywords 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
ec nomenclature
pdb deposition date 2016-06-13
KnotProt deposition date 2018-10-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling