5LQWY

Yeast activated spliceosome
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 17-65 49 1-16, 66-90 16 25 knot
Chain Sequence
FDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICN-NVGVNDAFYCWECCRLGKDKDGCPRILNLGSN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 15-73 59 1-14, 74-89 14 16 knot
view details
3.1m 13-65 53 1-12 74-89 66-73 12 16 slipknot
sequence length 90
structure length 89
publication title Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
pubmed doi rcsb
molecule tags Splicing
molecule keywords Pre-mRNA-splicing factor 8
source organism Saccharomyces cerevisiae
missing residues 58
ec nomenclature
pdb deposition date 2016-08-17
KnotProt deposition date 2017-02-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling