5LUEA

Minor form of the recombinant cytotoxin-1 from n. oxiana
Cysteine knot
Loop Piercing
view details
3-c-14-b-38-c-38 3-b-21
Chain Sequence
MLKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN
sequence length 61
structure length 61
publication title Structural and Dynamic "Portraits" of Recombinant and Native Cytotoxin I from Naja oxiana: How Close Are They?
pubmed doi rcsb
molecule tags Toxin
molecule keywords VC-1=CYTOTOXIN
source organism Naja oxiana
ec nomenclature
pdb deposition date 2016-09-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling