
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 49-171 | 123 | 1-48, 172-209 | 48 | 38 | knot |
Chain Sequence |
AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEVREVTELIKVDKVKIVACDGKNTANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 38-200 | 163 | 201-209 | 1-11 | 12-37 | 11 | 8 | slipknot | ||
view details |
![]() |
3.1 | 38-170 | 133 | 1-13, 188-209 | 14-37, 171-187 | 13 | 22 | slipknot | |||
view details |
![]() |
2.1 | 53-172 | 120 | 1-38, 186-209 | 39-52, 173-185 | 38 | 24 | slipknot | |||
view details |
![]() |
2.1 | 52-204 | 153 | 205-209 | 1-43 | 44-51 | 43 | 4 | slipknot |
sequence length |
209
|
structure length |
209
|
publication title |
Architecture of TAF11/TAF13/TBP complex suggests novel regulation properties of general transcription factor TFIID.
pubmed doi rcsb |
molecule tags |
Transcription
|
molecule keywords |
Transcription initiation factor IIA subunit 2,Transcription
|
source organism |
Homo sapiens
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2016-10-19 |
KnotProt deposition date | 2017-11-29 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...