5M4SA

Transcription factor tfiia as a single chain protein
Knot K +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 49-171 123 1-48, 172-209 48 38 knot
Chain Sequence
AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEVREVTELIKVDKVKIVACDGKNTANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 38-200 163 201-209 1-11 12-37 11 8 slipknot
view details
3.1 38-170 133 1-13, 188-209 14-37, 171-187 13 22 slipknot
view details
2.1 53-172 120 1-38, 186-209 39-52, 173-185 38 24 slipknot
view details
2.1 52-204 153 205-209 1-43 44-51 43 4 slipknot
sequence length 209
structure length 209
publication title Architecture of TAF11/TAF13/TBP complex suggests novel regulation properties of general transcription factor TFIID.
pubmed doi rcsb
molecule tags Transcription
molecule keywords Transcription initiation factor IIA subunit 2,Transcription
source organism Homo sapiens
total genus Genus: 70
ec nomenclature
pdb deposition date 2016-10-19
KnotProt deposition date 2017-11-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.