5M4SA

Transcription factor tfiia as a single chain protein
Knot K +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 49-171 123 1-48, 172-209 48 38 knot
Chain Sequence
AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEVREVTELIKVDKVKIVACDGKNTANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 38-200 163 201-209 1-11 12-37 11 8 slipknot
view details
3.1 38-170 133 1-13, 188-209 14-37, 171-187 13 22 slipknot
view details
2.1 53-172 120 1-38, 186-209 39-52, 173-185 38 24 slipknot
view details
2.1 52-204 153 205-209 1-43 44-51 43 4 slipknot
publication title Architecture of TAF11/TAF13/TBP complex suggests novel regulation properties of general transcription factor TFIID.
pubmed doi rcsb
structure length 209
molecule tags Transcription
source organism Homo sapiens
sequence length 209
total genus Genus: 70
molecule keywords Transcription initiation factor IIA subunit 2,Transcription
ec nomenclature
pdb deposition date 2016-10-19
KnotProt deposition date 2017-11-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling