| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 10-c-13-b-33-c-33 | 10-b-13 |
Chain Sequence |
SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKK
|
| sequence length |
63
|
| structure length |
63
|
| publication title |
Structural Basis of RNA Polymerase I Transcription Initiation.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
DNA-directed RNA polymerase I subunit RPA190
|
| source organism |
Saccharomyces cerevisiae
|
| ec nomenclature | |
| pdb deposition date | 2017-02-14 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
