5N61I

Rna polymerase i initially transcribing complex
Cysteine knot
Loop Piercing
view details
10-c-13-b-33-c-33 10-b-13
Chain Sequence
SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKK
sequence length 63
structure length 63
publication title Structural Basis of RNA Polymerase I Transcription Initiation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase I subunit RPA190
source organism Saccharomyces cerevisiae
ec nomenclature
pdb deposition date 2017-02-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling