| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 21-68 | 48 | 1-20, 69-103 | 20 | 35 | knot |
Chain Sequence |
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 19-70 | 52 | 1-18, 71-103 | 18 | 33 | knot |
| sequence length |
103
|
| structure length |
103
|
| publication title |
Structure of a pre-catalytic spliceosome.
pubmed doi rcsb |
| molecule tags |
Splicing
|
| molecule keywords |
U2 snRNA
|
| total genus |
 Genus: 16
|
| ec nomenclature | |
| pdb deposition date | 2017-04-24 |
| KnotProt deposition date | 2018-09-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
