Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 21-68 | 48 | 1-20, 69-103 | 20 | 35 | knot |
Chain Sequence |
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 19-70 | 52 | 1-18, 71-103 | 18 | 33 | knot |
sequence length |
103
|
structure length |
103
|
publication title |
Structure of a pre-catalytic spliceosome.
pubmed doi rcsb |
molecule tags |
Splicing
|
molecule keywords |
U2 snRNA
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2017-04-24 |
KnotProt deposition date | 2018-09-16 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...