| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 57-c-61-b-104-c-102 | 26-b-68 |
Chain Sequence |
MVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
|
| sequence length |
95
|
| structure length |
95
|
| publication title |
Two-faced Fcab prevents polymerization with VEGF and reveals thermodynamics and the 2.15 angstrom crystal structure of the complex.
pubmed doi rcsb |
| molecule tags |
Immune system
|
| molecule keywords |
Immunoglobulin gamma-1 heavy chain
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2017-05-29 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
