5O9Zy

Cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 14-63 50 1-13, 64-90 13 27 knot
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 14-80 67 1-13, 81-89 13 9 knot
view details
3.1m 13-65 53 1-12 81-89 66-80 12 9 slipknot
sequence length 89
structure length 89
publication title Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
pubmed doi rcsb
molecule tags Splicing
molecule keywords Pre-mRNA-processing-splicing factor 8
ec nomenclature
pdb deposition date 2017-06-20
KnotProt deposition date 2018-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling