5O9Zy

Cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
Knot K -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 14-63 50 1-13, 64-90 13 27 knot
Chain Sequence
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSK
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 14-80 67 1-13, 81-89 13 9 knot
view details
3.1m 13-65 53 1-12 81-89 66-80 12 9 slipknot
sequence length 89
structure length 89
publication title Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
pubmed doi rcsb
molecule tags Splicing
molecule keywords Pre-mRNA-processing-splicing factor 8
ec nomenclature
pdb deposition date 2017-06-20
KnotProt deposition date 2018-09-16
Image from the rcsb pdb (www.rcsb.org)
5O9Zy 5Z566 5Z576 6FF4y
similar chains in the KnotProt database (40% sequence similarity)
5Z586 6AH06 6AHD6 6FF7y 6Y50y
similar chains in the pdb database (40% sequence similarity)

  
#similar chains in the KnotProt database (40% sequence similarity)
5O9Z y; 5Z56 6; 5Z57 6; 6FF4 y; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)
5Z58 6; 6AH0 6; 6AHD 6; 6FF7 y; 6Y50 y;
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.