| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 14-63 | 50 | 1-13, 64-90 | 13 | 27 | knot |
Chain Sequence |
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 14-80 | 67 | 1-13, 81-89 | 13 | 9 | knot | ||||
| view details |
|
3.1m | 13-65 | 53 | 1-12 | 81-89 | 66-80 | 12 | 9 | slipknot |
| sequence length |
89
|
| structure length |
89
|
| publication title |
Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
pubmed doi rcsb |
| molecule tags |
Splicing
|
| molecule keywords |
Pre-mRNA-processing-splicing factor 8
|
| ec nomenclature | |
| pdb deposition date | 2017-06-20 |
| KnotProt deposition date | 2018-09-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
