5OBDA

X-ray structure of the adduct formed upon reaction of ribonuclease a with the compound fac-[ruii(co)3cl2(n3-mim), mim=methyl-imidazole
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 124
structure length 124
publication title Ru-Based CO releasing molecules with azole ligands: interaction with proteins and the CO release mechanism disclosed by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease pancreatic
ec nomenclature
pdb deposition date 2017-06-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.