5T3MA

Solution structure of a triple mutant of hwtx-iv - a potent blocker of nav1.7
Cysteine knot
Loop Piercing
view details
2-c-9-b-24-c-17 16-b-31
Chain Sequence
GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI
sequence length 35
structure length 35
publication title The structure, dynamics and selectivity profile of a NaV1.7 potency-optimised huwentoxin-IV variant.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mu-theraphotoxin-Hs2a
source organism Haplopelma schmidti
ec nomenclature
pdb deposition date 2016-08-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.