5T4RA

Nmr solution structure of the nav1.7 selective spider venom-derived peptide pn3a
Cysteine knot
Loop Piercing
view details
2-c-9-b-21-c-16 15-b-28
Chain Sequence
DCRYMFGDCEKDEDCCKHLGCKRKMKYCAWDFTFT
sequence length 35
structure length 35
publication title Analgesia from inhibition of NaV1.7 by novel spider venom-derived peptide Pn3a requires synergy with opioids
rcsb
molecule tags Toxin
molecule keywords Mu-theraphotoxin-Pn3a
ec nomenclature
pdb deposition date 2016-08-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling