Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 12-268 | 257 | 1-11, 269-388 | 11 | 120 | knot |
Chain Sequence |
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 18-279 | 262 | 1-17 | 345-388 | 280-344 | 17 | 44 | slipknot | ||
view details |
![]() |
3.1 | 8-344 | 337 | 1-7 | 347-388 | 345-346 | 7 | 42 | slipknot | ||
view details |
![]() |
2.1 | 18-365 | 348 | 366-388 | 1-4 | 5-17 | 4 | 22 | slipknot | ||
view details |
![]() |
1.1 | 17-352 | 336 | 1-6, 365-388 | 7-16, 353-364 | 6 | 24 | slipknot | |||
view details |
![]() |
1.1 | 18-247 | 230 | 1-7, 257-388 | 8-17, 248-256 | 7 | 132 | slipknot |
sequence length |
388
|
structure length |
388
|
publication title |
Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb |
molecule tags |
Transferase
|
molecule keywords |
S-adenosylmethionine synthase
|
source organism |
Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2016-09-08 |
KnotProt deposition date | 2016-10-03 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...