5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 17-265 249 1-16, 266-388 16 123 knot
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIA---------DLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 21-274 254 1-4, 346-379 5-20, 275-345 4 34 slipknot
view details
2.1 19-362 344 363-379 1-4 5-18 4 16 slipknot
view details
1.1 17-236 220 1-5, 248-379 6-16, 237-247 5 132 slipknot
view details
1.1 17-247 231 1-7, 249-379 8-16, 248-248 7 131 slipknot
view details
1.1 18-345 328 1-6, 358-379 7-17, 346-357 6 22 slipknot
sequence length 388
structure length 379
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
missing residues 104-112
total genus Genus: 129
ec nomenclature
pdb deposition date 2016-09-08
KnotProt deposition date 2016-10-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling