| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 31-219 | 189 | 1-30, 220-226 | 30 | 7 | knot |
Chain Sequence |
KWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKSSAETR
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 10-222 | 213 | 1-9, 223-226 | 9 | 4 | knot | ||||
| view details |
|
2.1 | 31-216 | 186 | 1-30 | 223-226 | 217-222 | 30 | 4 | slipknot | ||
| view details |
|
3.1 | 29-222 | 194 | 223-226 | 1-10 | 11-28 | 10 | 3 | slipknot |
| sequence length |
226
|
| structure length |
226
|
| publication title |
Structure-Activity Relationship for Sulfonamide Inhibition of Helicobacter pylori alpha-Carbonic Anhydrase.
pubmed doi rcsb |
| molecule tags |
Lyase/lyase inhibitor
|
| molecule keywords |
Alpha-carbonic anhydrase
|
| source organism |
Helicobacter pylori (strain atcc 700392 / 26695)
|
| total genus |
Genus: 38
|
| ec nomenclature | |
| pdb deposition date | 2016-11-07 |
| KnotProt deposition date | 2017-09-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...