5VT2B

Crystal structure of growth differentiation factor
Cysteine knot
Loop Piercing
view details
44-c-48-b-111-c-109 15-b-78
Chain Sequence
DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
sequence length 108
structure length 108
publication title Long-acting MIC-1/GDF15 molecules to treat obesity: Evidence from mice to monkeys.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Growth/differentiation factor 15
source organism Homo sapiens
ec nomenclature
pdb deposition date 2017-05-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling