5W64J

Rna polymerase i initial transcribing complex state 1
Cysteine knot
Loop Piercing
view details
7-c-10-b-45-c-10 10-b-46
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
sequence length 69
structure length 69
publication title Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
ec nomenclature
pdb deposition date 2017-06-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling