| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 7-c-10-b-45-c-10 | 10-b-46 |
Chain Sequence |
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
|
| sequence length |
69
|
| structure length |
69
|
| publication title |
Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
pubmed doi rcsb |
| molecule tags |
Transcription
|
| molecule keywords |
DNA-directed RNA polymerase I subunit RPA190
|
| source organism |
Saccharomyces cerevisiae (strain atcc 204508 / s288c)
|
| ec nomenclature | |
| pdb deposition date | 2017-06-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
