| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 89-133 | 45 | 1-88, 134-248 | 88 | 115 | knot |
Chain Sequence |
SMLWVGVVSIFPEMFRAISDYGITSRAVKQGLLTLTCWNPRVYTEDRHQTVDDRPFGGGPGMVMKIKPLEGALADARQAAGGRKAKVIYLSPQGRQLTQAGVRELAEEEALILIAGRYEGIDERFIEEHVDEEWSIGDYVLSGGELPAMVLVDAVTRLLPGAL----------FTDGLLDCPHYTRPEVYADKRVPEVLLSGNHEHIRRWRLQQALGRTWERRADLLDSRSLSGEEQKLLAEYIRQRD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 89-134 | 46 | 1-88, 135-238 | 88 | 104 | knot |
| sequence length |
248
|
| structure length |
238
|
| publication title |
Crystal Structure and catalytic mechanism of the essential m1G37 tRNA methyltransferase TrmD from Pseudomonas aeruginosa
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Pseudomonas aeruginosa (strain ucbpp-pa14)
|
| missing residues |
164-173
|
| total genus |
 Genus: 69
|
| ec nomenclature | |
| pdb deposition date | 2017-01-15 |
| KnotProt deposition date | 2017-12-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
