| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 90-133 | 44 | 1-89, 134-248 | 89 | 115 | knot |
Chain Sequence |
SMLWVGVVSIFPEMFRAISDYGITSRAVKQGLLTLTCWNPRVYTEDRHQTVDDRPFGGGPGMVMKIKPLEGALADARQAAGGRKAKVIYLSPQGRQLTQAGVRELAEEEALILIAGRYEGIDERFIEEHVDEEWSIGDYVLSGGELPAMVLVDAVTRLLPGALG------EDSFTDGLLDCPHYTRPEVYADKRVPEVLLSGNHEHIRRWRLQQALGRTWERRADLLDSRSLSGEEQKLLAEYIRQRD
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
3.1 | 89-134 | 46 | 1-88, 135-242 | 88 | 108 | knot | ||||
| view details |
|
2.1 | 86-131 | 46 | 1-85 | 137-242 | 132-136 | 85 | 106 | slipknot | ||
| view details |
|
|
2.1 | 91-168 | 78 | 1-88, 177-242 | 89-90, 169-176 | 88 | 66 | slipknot | ||
| view details |
|
|
2.1 | 91-192 | 102 | 1-88, 205-242 | 89-90, 193-204 | 88 | 38 | slipknot | ||
| view details |
|
|
2.1 | 91-205 | 115 | 1-88, 233-242 | 89-90, 206-232 | 88 | 10 | slipknot |
| sequence length |
248
|
| structure length |
242
|
| publication title |
Crystal Structure and catalytic mechanism of TrmD from Pseudomonas aeruginosa, a m1G37 tRNA methyltransferase essential for bacterial survival
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Pseudomonas aeruginosa (strain ucbpp-pa14)
|
| missing residues |
165-170
|
| total genus |
Genus: 71
|
| ec nomenclature | |
| pdb deposition date | 2017-01-15 |
| KnotProt deposition date | 2017-12-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...