5YLCA

Crystal structure of mcr-1 catalytic domain
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 128
Slipknot S +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 26-248 223 1-25 277-330 249-276 25 54 slipknot
Chain Sequence
KDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTS-AYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIRLEHHH
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 9-246 238 1-8 252-329 247-251 8 78 slipknot
view details
3.1 25-249 225 1-24 275-329 250-274 24 55 slipknot
view details
3.1 15-274 260 1-7, 277-329 8-14, 275-276 7 53 slipknot
view details
2.1 15-276 262 1-9, 278-329 10-14, 277-277 9 52 slipknot
view details
2.1 22-274 253 1-14, 277-329 15-21, 275-276 14 53 slipknot
view details
2.1 21-276 256 1-15, 278-329 16-20, 277-277 15 52 slipknot
sequence length 330
structure length 329
publication title Substrate analog interaction with MCR-1 offers insight into the rising threat of the plasmid-mediated transferable colistin resistance.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
source organism Escherichia coli
missing residues 69
total genus Genus: 128
ec nomenclature
pdb deposition date 2017-10-17
KnotProt deposition date 2017-11-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling