| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 16-62 | 47 | 1-15, 63-85 | 15 | 23 | knot |
Chain Sequence |
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 13-70 | 58 | 1-12, 71-85 | 12 | 15 | knot | ||||
| view details |
 |
2.1m | 13-62 | 50 | 1-12 | 71-85 | 63-70 | 12 | 15 | slipknot |
| sequence length |
85
|
| structure length |
85
|
| publication title |
The cryo-EM structure of the SF3b spliceosome complex bound to a splicing modulator reveals a pre-mRNA substrate competitive mechanism of action
pubmed doi rcsb |
| molecule tags |
Splicing
|
| molecule keywords |
Splicing factor 3B subunit 5
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2018-02-23 |
| KnotProt deposition date | 2018-03-21 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
