5ZJVA

Crystal structure of the catalytic domain of mcr-1 (cmcr-1) in complex with xylose
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 123
Slipknot S +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 28-248 221 1-27 278-331 249-277 27 54 slipknot
Chain Sequence
PKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTS-AYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIRLEHHH
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 11-246 236 1-10 253-330 247-252 10 78 slipknot
view details
3.1 26-249 224 1-25 273-330 250-272 25 58 slipknot
view details
3.1 26-272 247 1-25 276-330 273-275 25 55 slipknot
sequence length 331
structure length 330
publication title Crystal Structure of the Catalytic Domain of MCR-1 (cMCR-1) in Complex with d-Xylose
doi rcsb
molecule tags Transferase
molecule keywords Probable phosphatidylethanolamine transferase Mcr-1
source organism Escherichia coli
missing residues 70
total genus Genus: 123
ec nomenclature
pdb deposition date 2018-03-22
KnotProt deposition date 2018-04-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling