5ZWM5

Cryo-em structure of the yeast pre-b complex at an average resolution of 3.4~4.6 angstrom (tri-snrnp and u2 snrnp part)
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 19-69 51 1-18, 70-103 18 34 knot
Chain Sequence
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 19-72 54 1-18, 73-103 18 31 knot
sequence length 103
structure length 103
publication title Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
pubmed doi rcsb
molecule tags Splicing
molecule keywords Pre-mRNA-splicing factor 8
total genus Genus: 14
ec nomenclature
pdb deposition date 2018-05-16
KnotProt deposition date 2018-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling