Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | -31 | 20-68 | 49 | 1-19, 69-103 | 19 | 35 | knot |
Chain Sequence |
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 3.1m | 19-71 | 53 | 1-18, 72-103 | 18 | 32 | knot |
sequence length |
103
|
structure length |
103
|
publication title |
Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
pubmed doi rcsb |
molecule tags |
Splicing
|
molecule keywords |
Pre-mRNA-splicing factor 8
|
total genus |
Genus: 10
|
ec nomenclature | |
pdb deposition date | 2018-05-16 |
KnotProt deposition date | 2018-09-14 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...