
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 19-67 | 49 | 1-18, 68-100 | 18 | 33 | knot |
Chain Sequence |
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
|
![]() |
- 31 | 10-58 | 49 | 1-9, 59-76 | 9 | 18 | knot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K -31 | Cys11 ... Cys85 <-> Bridging ionZn201 <-> Cys11 |
ion-based | |||
|
K -31 | Cys11 <-> Bridging ionZn201 <-> Cys85 ... Cys26 <-> Bridging ionZn202 <-> Cys23 ... Cys11 |
ion-based | |||
|
K -31 | Cys11 ... Cys58 <-> Bridging ionZn202 <-> Cys61 ... Cys85 <-> Bridging ionZn201 <-> Cys11 |
ion-based | |||
|
K -31 | Cys11 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Cys85 <-> Bridging ionZn201 <-> Cys11 |
ion-based | |||
|
K -31 | Ala2 ... Cys46 <-> Bridging ionZn201 <-> Cys49 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Chain closureAla2 <-> Glu101 ... Cys26 <-> Bridging ionZn202 <-> Cys23 ... Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys58 <-> Bridging ionZn202 <-> Cys61 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Cys11 <-> Bridging ionZn201 <-> Cys85 ... Cys75 <-> Bridging ionZn203 <-> Cys72 ... Cys26 <-> Bridging ionZn202 <-> Cys23 ... Cys11 |
ion-based | |||
|
K -31 | Cys11 ... Cys58 <-> Bridging ionZn202 <-> Cys61 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Cys85 <-> Bridging ionZn201 <-> Cys11 |
ion-based | |||
|
K -31 | Chain closureAla2 <-> Glu101 ... Cys49 <-> Bridging ionZn201 <-> Cys46 ... Cys26 <-> Bridging ionZn202 <-> Cys23 ... Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys46 <-> Bridging ionZn201 <-> Cys49 ... Cys58 <-> Bridging ionZn202 <-> Cys61 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys46 <-> Bridging ionZn201 <-> Cys49 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys23 <-> Bridging ionZn202 <-> Cys26 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys58 <-> Bridging ionZn202 <-> Cys61 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys23 <-> Bridging ionZn202 <-> Cys26 ... Cys46 <-> Bridging ionZn201 <-> Cys49 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureGlu101 <-> Ala2 |
probabilistic | |||
|
K -31 | Ala2 ... Cys46 <-> Bridging ionZn201 <-> Cys49 ... Cys58 <-> Bridging ionZn202 <-> Cys61 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureGlu101 <-> Ala2 |
probabilistic |
Chain Sequence |
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 19-86 | 68 | 1-18, 87-100 | 18 | 14 | knot | ||||
view details |
![]() |
3.1m | 17-69 | 53 | 1-16 | 87-100 | 70-86 | 16 | 14 | slipknot |
sequence length |
100
|
structure length |
100
|
publication title |
Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
pubmed doi rcsb |
molecule tags |
Splicing
|
molecule keywords |
RNA-binding motif protein, X-linked 2
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2018-01-03 |
KnotProt deposition date | 2018-10-18 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...