| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-253 | 230 | 254-257 | 1-1 | 2-23 | 1 | 3 | slipknot |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 22-254 | 233 | 255-257 | 1-1 | 2-21 | 1 | 2 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureLys260 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> His4 |
probabilistic |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type |
|---|
| sequence length |
257
|
| structure length |
257
|
| publication title |
Inhibitor-Polymer Conjugates as a Versatile Tool for Detection and Visualization of Cancer-Associated Carbonic Anhydrase Isoforms
doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 79
|
| ec nomenclature | |
| pdb deposition date | 2018-06-27 |
| KnotProt deposition date | 2019-05-15 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
