
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 21-258 | 238 | 259-261 | 1-4 | 5-20 | 4 | 2 | slipknot |
Chain Sequence |
GMSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
|
![]() |
+ 31 | 24-257 | 234 | 258-261 | 1-1 | 2-23 | 1 | 3 | slipknot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Chain closureGly0 <-> Phe260 ... His96 <-> Bridging ionZn301 <-> His94 ... Gly0 |
probabilistic | |||
|
K +31 | Gly0 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Gly0 |
probabilistic | |||
|
K +31 | Gly0 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Gly0 |
probabilistic |
Chain Sequence |
GMSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 28-255 | 228 | 1-27, 256-260 | 27 | 5 | knot |
sequence length |
260
|
structure length |
260
|
publication title |
Exploring structural properties of potent human carbonic anhydrase inhibitors bearing a 4-(cycloalkylamino-1-carbonyl)benzenesulfonamide moiety.
pubmed doi rcsb |
molecule tags |
Lyase
|
molecule keywords |
Carbonic anhydrase 2
|
source organism |
Homo sapiens
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2018-07-17 |
KnotProt deposition date | 2019-01-08 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...