| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-255 | 232 | 1-23, 256-259 | 23 | 4 | knot |
Chain Sequence |
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 24-255 | 232 | 1-23, 256-259 | 23 | 4 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Gly4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureAla262 <-> Gly4 |
probabilistic | |||
|
|
K +31 | Gly4 ... Cys54 <-> Cys178 ... Chain closureAla262 <-> Gly4 |
probabilistic | |||
|
|
K +31 | Gly4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureAla262 <-> Gly4 |
probabilistic | |||
|
|
K +31 | Gly4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureAla262 <-> Gly4 |
probabilistic |
Chain Sequence |
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 26-256 | 231 | 1-25, 257-259 | 25 | 3 | knot | ||||
| view details |
 |
2.1 | 24-252 | 229 | 1-23 | 257-259 | 253-256 | 23 | 3 | slipknot |
| sequence length |
259
|
| structure length |
259
|
| publication title |
Exploring structural properties of potent human carbonic anhydrase inhibitors bearing a 4-(cycloalkylamino-1-carbonyl)benzenesulfonamide moiety.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 7
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 79
|
| ec nomenclature | |
| pdb deposition date | 2018-07-17 |
| KnotProt deposition date | 2019-01-08 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
