Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 21-254 | 234 | 1-20, 255-258 | 20 | 4 | knot |
Chain Sequence |
WGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
+ 31 | 22-252 | 231 | 1-21, 253-258 | 21 | 5 | slipknot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Trp5 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureAla262 <-> Trp5 |
probabilistic | |||
|
K +31 | Trp5 ... Cys54 <-> Cys178 ... Chain closureAla262 <-> Trp5 |
probabilistic | |||
|
K +31 | Trp5 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureAla262 <-> Trp5 |
probabilistic | |||
|
K +31 | Trp5 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureAla262 <-> Trp5 |
probabilistic |
Chain Sequence |
WGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 3.1 | 25-255 | 231 | 1-24, 256-258 | 24 | 3 | knot | |||||
view details | 2.1 | 23-251 | 229 | 1-22 | 257-258 | 252-256 | 22 | 2 | slipknot |
sequence length |
258
|
structure length |
258
|
publication title |
Exploring structural properties of potent human carbonic anhydrase inhibitors bearing a 4-(cycloalkylamino-1-carbonyl)benzenesulfonamide moiety.
pubmed doi rcsb |
molecule tags |
Lyase
|
molecule keywords |
Carbonic anhydrase 7
|
source organism |
Homo sapiens
|
total genus |
Genus: 77
|
ec nomenclature | |
pdb deposition date | 2018-07-17 |
KnotProt deposition date | 2019-01-08 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...