| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 346-c-350-b-413-c-411 | 317-b-380 |
Chain Sequence |
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
|
| sequence length |
112
|
| structure length |
112
|
| publication title |
Recombinant production, purification, crystallization, and structure analysis of human transforming growth factor beta 2 in a new conformation.
pubmed doi rcsb |
| molecule tags |
Cytokine
|
| molecule keywords |
Transforming growth factor beta-2 proprotein
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2018-11-23 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
