| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 19-67 | 49 | 1-18, 68-100 | 18 | 33 | knot |
Chain Sequence |
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 19-85 | 67 | 1-18, 86-100 | 18 | 15 | knot | ||||
| view details |
|
3.1m | 18-69 | 52 | 1-17 | 86-100 | 70-85 | 17 | 15 | slipknot |
| sequence length |
100
|
| structure length |
100
|
| publication title |
Mechanism of 5' splice site transfer for human spliceosome activation.
pubmed doi rcsb |
| molecule tags |
Splicing
|
| molecule keywords |
U1 snRNA
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 11
|
| ec nomenclature | |
| pdb deposition date | 2019-03-07 |
| KnotProt deposition date | 2019-04-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
