| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-253 | 230 | 1-23, 254-259 | 23 | 5 | slipknot |
Chain Sequence |
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 22-234 | 213 | 1-21, 235-238 | 21 | 4 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Gly4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureAla262 <-> Gly4 |
probabilistic | |||
|
|
K +31 | Chain closureGly4 <-> Ala262 ... Cys178 <-> Cys54 ... Gly4 |
probabilistic | |||
|
|
K +31 | Gly4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureAla262 <-> Gly4 |
probabilistic | |||
|
|
K +31 | Gly4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureAla262 <-> Gly4 |
probabilistic |
Chain Sequence |
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 26-256 | 231 | 1-25, 257-259 | 25 | 3 | knot | ||||
| view details |
 |
2.1 | 24-252 | 229 | 1-23 | 258-259 | 253-257 | 23 | 2 | slipknot |
| sequence length |
259
|
| structure length |
259
|
| publication title |
Phenyl(thio)phosphon(amid)ate Benzenesulfonamides as Potent and Selective Inhibitors of Human Carbonic Anhydrases II and VII Counteract Allodynia in a Mouse Model of Oxaliplatin-Induced Neuropathy.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 7
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 78
|
| ec nomenclature |
ec
4.2.1.1: Alcohol dehydrogenase. |
| pdb deposition date | 2019-07-29 |
| KnotProt deposition date | 2020-08-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
