6T7U | KnotProt

Genus: 80
Alphaknot: P00918

Slipknot S +3₁

script 1 started

platformSpeed = 8

JSmol exec jmolApplet1 start applet null

Jmol JavaScript applet jmolApplet1__727812186029344__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet1__727812186029344__)

vwrOptions:

{ "name":"jmolApplet1","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/6T7U/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet1__727812186029344__","codePath":"https:/static/js/j2s/","display":"jmolApplet1_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"727812186029344","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/6T7U/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet1 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet1__727812186029344__ ready

Help Knotting data interpretation Full screen

					Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details				+3₁	23-253	231	1-22, 254-257			22	3	slipknot

Chain Sequence

HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVVFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K 3x +3₁

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__727812186029344__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__727812186029344__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/6T7U/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__727812186029344__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"727812186029344","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/6T7U/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__727812186029344__ ready

script 1 started

platformSpeed = 8

Viewer cachePut cache://localLOAD_/static/knot_data/6t7u/A/6t7u_A.pdb.gz

Viewer cachePut https://knotprot.cent.uw.edu.pl/static/knot_data/6t7u/A/6t7u_A.pdb.gz

Viewer cachePut cache://localLOAD_/static/knot_data/6t7u/A/6t7u_A.pdb.gz

Viewer cachePut https://knotprot.cent.uw.edu.pl/static/knot_data/6t7u/A/6t7u_A.pdb.gz

Viewer cachePut cache://localLOAD_/static/knot_data/6t7u/A/6t7u_A.pdb.gz

Viewer cachePut https://knotprot.cent.uw.edu.pl/static/knot_data/6t7u/A/6t7u_A.pdb.gz

Help Knotting data interpretation Full screen

		Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details	+ 3₁	24-253	230	1-23, 254-257			23	4	knot
view details	+ 3₁	24-232	209	1-23, 233-236			23	4	knot
view details	+ 3₁	24-230	207	231-234	1-1	2-23	1	3	slipknot

	Fingerprint	Knot forming loop	Loop type
knots details	K +3₁	His4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureLys260 <-> His4	probabilistic	color sequence
knots details	K +3₁	His4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> His4	probabilistic	color sequence
knots details	K +3₁	His4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> His4	probabilistic	color sequence

Chain Sequence

Whole chain analysis

Help Knotoid data interpretation Full screen

Subchain analysis

Knotoid cutoff: 0.5

Knotoid matrix content: 1

script 1 started

platformSpeed = 8

JSmol exec jmolApplet2 start applet null

Jmol JavaScript applet jmolApplet2__727812186029344__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet2__727812186029344__)

vwrOptions:

{ "name":"jmolApplet2","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/6T7U/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet2__727812186029344__","codePath":"https:/static/js/j2s/","display":"jmolApplet2_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"727812186029344","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/6T7U/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet2 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet2__727812186029344__ ready

Help Knotoid subchains data interpretation Full screen

					Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details				2.1	24-251	228	1-23	257-257	252-256	23	1	slipknot
view details				1.1	29-251	223		1-23, 256-257	24-28, 252-255	23	2	slipknot

sequence length	257
structure length	257
publication title	Sulfonamido carboranes as highly selective inhibitors of cancer-specific carbonic anhydrase IX. pubmed doi rcsb
molecule tags	Lyase
molecule keywords	Carbonic anhydrase 2
source organism	Homo sapiens
total genus	Genus: 80
ec nomenclature	ec 4.2.1.1: Alcohol dehydrogenase.
pdb deposition date	2019-10-23
KnotProt deposition date	2020-08-05

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
A	PF00194	Carb_anhydrase	Eukaryotic-type carbonic anhydrase

Image from the rcsb pdb (www.rcsb.org)

4R59A 4R5AA 4RIUA 4RIVA 4ZAOA 6FJIA 6FJJA 6GCYA 6T9ZA
similar chains in the KnotProt database (40% sequence similarity)

None
similar chains in the pdb database (40% sequence similarity)

#similar chains in the KnotProt database (40% sequence similarity)
4R59 A; 4R5A A; 4RIU A; 4RIV A; 4ZAO A; 6FJI A; 6FJJ A; 6GCY A; 6T9Z A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)

6T7UA

Slipknot S +31

Chain Sequence

Knot K 3x +31

Chain Sequence

pfam database annotations

Slipknot S +3₁

Knot K 3x +3₁