| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 13-c-20-b-40-c-26 | 25-b-54 |
Chain Sequence |
SAKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV
|
| sequence length |
57
|
| structure length |
57
|
| publication title |
Structural basis for the modulation of voltage-gated sodium channels by animal toxins.
pubmed doi rcsb |
| molecule tags |
Membrane protein/toxin
|
| molecule keywords |
Sodium channel protein PaFPC1
|
| source organism |
Periplaneta americana
|
| ec nomenclature | |
| pdb deposition date | 2018-07-11 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
