| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-254 | 231 | 1-23, 255-264 | 23 | 10 | knot |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNGEGEPEEPMVDNWRPTQPLKNRQIKASFKHHHHHH
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 26-254 | 229 | 1-25, 255-264 | 25 | 10 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Chain closureHis4 <-> His267 ... His96 <-> Bridging ionZn302 <-> His94 ... His4 |
probabilistic | |||
|
|
K +31 | Chain closureHis4 <-> His267 ... His119 <-> Bridging ionZn302 <-> His96 ... His4 |
probabilistic | |||
|
|
K +31 | Chain closureHis4 <-> His267 ... His119 <-> Bridging ionZn302 <-> His94 ... His4 |
probabilistic |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNGEGEPEEPMVDNWRPTQPLKNRQIKASFKHHHHHH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 26-255 | 230 | 1-25, 256-263 | 25 | 8 | knot | ||||
| view details |
 |
2.1 | 24-251 | 228 | 1-23 | 257-263 | 252-256 | 23 | 7 | slipknot |
| sequence length |
263
|
| structure length |
263
|
| publication title |
Structural insights into a thermostable variant of human carbonic anhydrase II.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 74
|
| ec nomenclature | |
| pdb deposition date | 2017-09-13 |
| KnotProt deposition date | 2018-10-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
