| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 6-264 | 259 | 1-5 | 294-452 | 265-293 | 5 | 159 | slipknot |
Chain Sequence |
QKPNIILIVADDLGYADVGFNGSKDIITPNIDDLAKSGTSFSDAYVAHPFSGPSRAALMTGRYPHKIGSQFNLPTRGSNVGVPTDAKFISKLLNENNYFTGALGKWHMGDTPQHHPNKRGFDEYYGFLGGGHNYFPDQYQPQYKKQKAQGLKNIFEYITPLEHNGKEVKETQYITDALSREAVNFVDKAVNKKHPFFLYLAYNAPHTPLQAKDEDMAMFPNIKNKDRKTYAGMVYAVDRGVGKLVEALKKNNQYDNTLIVFMSDNGGKLSKGANNFPLKAGKGSTQEGGFRVPMLFHWPKHVPAGKRFSHPVSALDLYPTFAALAGAKVEENQHLDGTNMWPAFIKNENPHKDEPIYALRHRKGYSDAAIRMNQWKALKVNQQPWQLFNIENDISEKHDVSKSNKALLTDMVREMEKWSWDNQQPSWFHETTEGVNWRLDAMPRFDKTFKTT
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 6-262 | 257 | 1-5 | 267-452 | 263-266 | 5 | 186 | slipknot | ||
| view details |
 |
3.1 | 5-272 | 268 | 1-4 | 288-452 | 273-287 | 4 | 165 | slipknot | ||
| view details |
|
2.1 | 8-286 | 279 | 1-7 | 291-452 | 287-290 | 7 | 162 | slipknot | ||
| view details |
|
3.1 | 9-280 | 272 | 1-4, 288-452 | 5-8, 281-287 | 4 | 165 | slipknot | |||
| view details |
|
2.1 | 9-287 | 279 | 1-7, 290-452 | 8-8, 288-289 | 7 | 163 | slipknot |
| sequence length |
452
|
| structure length |
452
|
| publication title |
The molecular basis of polysaccharide sulfatase activity and a nomenclature for active site sub-sites in this class of enzyme
rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Iota-carrageenan sulfatase
|
| source organism |
Pseudoalteromonas
|
| total genus |
 Genus: 160
|
| ec nomenclature | |
| pdb deposition date | 2017-09-19 |
| KnotProt deposition date | 2018-03-15 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
