6BA3A

Nmr structure of u21-hexatoxin-hi1a toxin from australian funnel-web spider hadronyche infensa
Cysteine knot
Loop Piercing
view details
23-c-30-b-49-c-37 36-b-64
Chain Sequence
SNRWNLGYGIPHKQVKLPNGQLCKEPGDSCSKRDECCKADDQKTYSSGCAQTWSAMEGGFVRECYICAVESSMC
sequence length 74
structure length 74
publication title Single-gene recruitment underlies venom complexity in the Australian Funnel-web spider Hadronyche infensa
rcsb
molecule tags Toxin
molecule keywords U21-hexatoxin-Hi1a
source organism Hadronyche infensa
ec nomenclature
pdb deposition date 2017-10-12
Image from the rcsb pdb (www.rcsb.org)
None
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)

#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.