| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 24-c-27-b-43-c-43 | 24-b-40 |
Chain Sequence |
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
|
| sequence length |
60
|
| structure length |
60
|
| publication title |
A structural basis for restricted codon recognition mediated by 2-thiocytidine in tRNA containing a wobble position inosine
rcsb |
| molecule tags |
Ribosome
|
| molecule keywords |
16s rRNA
|
| ec nomenclature | |
| pdb deposition date | 2018-06-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
