6DZWA

Cryo-em structure of the ts2-inactive human serotonin transporter in complex with paroxetine and 15b8 fab and 8b6 scfv
Slipknot S 41 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 37-273 237 274-537 1-20 21-36 20 263 slipknot
view details
41 13-300 288 1-12 353-537 301-352 12 185 slipknot
Chain Sequence
RETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIIASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPE
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 10-296 287 1-9 308-537 297-307 9 230 slipknot
view details
4.1 11-306 296 1-10 343-537 307-342 10 195 slipknot
view details
3.2 18-341 324 1-17 357-537 342-356 17 181 slipknot
view details
2.1 33-264 232 1-16, 283-537 17-32, 265-282 16 255 slipknot
view details
2.1 33-282 250 1-16, 286-537 17-32, 283-285 16 252 slipknot
view details
2.1 42-364 323 1-16, 402-537 17-41, 365-401 16 136 slipknot
view details
2.1 42-418 377 419-537 1-16 17-41 16 118 slipknot
view details
1.1 41-282 242 1-21, 303-537 22-40, 283-302 21 235 slipknot
view details
1.1 41-302 262 1-22, 304-537 23-40, 303-303 22 234 slipknot
view details
1.1 37-253 217 1-23, 267-537 24-36, 254-266 23 271 slipknot
view details
1.1 37-266 230 1-32, 270-537 33-36, 267-269 32 268 slipknot
view details
1.1 38-253 216 1-36, 266-537 37-37, 254-265 36 272 slipknot
view details
1.1 38-266 229 1-36, 270-537 37-37, 267-269 36 268 slipknot
publication title Cryo-EM structure of human serotonin transporter in complex with ibogaine
rcsb
structure length 537
molecule tags Transport protein/immune system
source organism Homo sapiens
sequence length 537
total genus Genus: 110
molecule keywords Sodium-dependent serotonin transporter
ec nomenclature
pdb deposition date 2018-07-05
KnotProt deposition date 2019-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling