| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 89-c-131-b-136-c-136 | 89-b-131 |
Chain Sequence |
LLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSS
|
| sequence length |
83
|
| structure length |
83
|
| publication title |
Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Lipoprotein lipase
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2018-07-26 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
