
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 71-140 | 70 | 1-1, 144-163 | 2-70, 141-143 | 1 | 20 | slipknot |
Chain Sequence |
SIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 77-138 | 62 | 1-76 | 146-163 | 139-145 | 76 | 18 | slipknot | ||
view details |
![]() |
1.1 | 82-139 | 58 | 1-76, 145-163 | 77-81, 140-144 | 76 | 19 | slipknot |
sequence length |
163
|
structure length |
163
|
publication title |
Structural basis of pan-ebolavirus neutralization by a human antibody against a conserved, yet cryptic epitope
doi rcsb |
molecule tags |
Viral protein/immune system
|
molecule keywords |
Envelope glycoprotein
|
source organism |
Zaire ebolavirus
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2018-08-02 |
KnotProt deposition date | 2018-09-25 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...