6EA7A

Structure of ebov gpcl in complex with the pan-ebolavirus mab adi-15878
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 71-140 70 1-1, 144-163 2-70, 141-143 1 20 slipknot
Chain Sequence
SIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 77-138 62 1-76 146-163 139-145 76 18 slipknot
view details
1.1 82-139 58 1-76, 145-163 77-81, 140-144 76 19 slipknot
sequence length 163
structure length 163
publication title Structural basis of pan-ebolavirus neutralization by a human antibody against a conserved, yet cryptic epitope
doi rcsb
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein
source organism Zaire ebolavirus
total genus Genus: 24
ec nomenclature
pdb deposition date 2018-08-02
KnotProt deposition date 2018-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.